{"product_id":"proteintech-27171-1-ap","title":"Proteintech, 27171-1-AP, Nectin-2\/CD112 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Nectin-2\/CD112 (27171-1-AP) by Proteintech is a Polyclonal antibody targeting Nectin-2\/CD112 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n27171-1-AP targets Nectin-2\/CD112 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat kidney tissue, HAP1 cells,  Jurkat cells,  mouse kidney tissue,  RAW 264.7 cells\nPositive IHC detected in: human tonsillitis tissue, human kidney tissue,  human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:3000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNectin 2, also named as PVRL2, CD112, HVEB, PRR2 and PVRR2, is an adhesion molecule widely expressed in cell lines of different lineages, including hematopoietic, neuronal, endothelial and epithelial cells. CD112 belongs to a new family of immunoglobulin-like molecules that includes four members (CD111, CD112, PRR3 and CD155) sharing an ectodomain made of three Ig domains, of V and C types. CD112 is expressed in the myelo-monocytic and megakaryocytic hematopoietic lineages and the function in hematopoiesis is currently unknown. CD112 is an intercellular homophilic adhesion. CD112 localizes specifically at adherents junctions via its cytoplasmic interaction with the scaffold F-actin binding protein afadin. Disruption of the murine CD112 gene leads to infertility of male mice with morphologically aberrant spermatozoa. CD112 mediates entry of some alphaherpesvirus mutants (also named HveB) via its V domain. CD112 is involved in cell to cell spreading of viruses.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26040 Product name: Recombinant human Nectin 2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 32-235 aa of BC003091 Sequence: QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVT Predict reactive species\nFull Name: poliovirus receptor-related 2 (herpesvirus entry mediator B)\nCalculated Molecular Weight: 58 kDa\nObserved Molecular Weight: 60-70 kDa\nGenBank Accession Number: BC003091\nGene Symbol: Nectin-2\/CD112\nGene ID (NCBI): 5819\nRRID: AB_2880784\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q92692\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868943241385,"sku":"27171-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27171-1-ap","provider":"Iright","version":"1.0","type":"link"}