{"product_id":"proteintech-27177-1-ap","title":"Proteintech, 27177-1-AP, WNT7A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe WNT7A (27177-1-AP) by Proteintech is a Polyclonal antibody targeting WNT7A in WB, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n27177-1-AP targets WNT7A in WB, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, mouse kidney tissue,  rat kidney tissue\nPositive IP detected in: mouse kidney tissue\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:300-1:1200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nWNT7A belongs to the Wnt family. WNT7A plays an important role in embryonic development, including dorsal versus ventral patterning during limb development, skeleton development and urogenital tract development (PMID: 16826533). WNT7A is required for central nervous system (CNS) angiogenesis and blood-brain barrier regulation (PMID:30026314). WNT7A is highly expressed in basal cells and is secreted in abundance by basal cells (PMID: 36318668).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26060 Product name: Recombinant human WNT7A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 130-305 aa of BC008811 Sequence: DCGCDKEKQGQYHRDEGWKWGGCSADIRYGIGFAKVFVDAREIKQNARTLMNLHNNEAGRKILEENMKLECKCHGVSGSCTTKTCWTTLPQFRELGYVLKDKYNEAVHVEPVRASRNKRPTFLKIKKPLSYRKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRACNKTAPQASGCD Predict reactive species\nFull Name: wingless-type MMTV integration site family, member 7A\nCalculated Molecular Weight: 39 kDa\nObserved Molecular Weight: 30-39 kDa\nGenBank Accession Number: BC008811\nGene Symbol: WNT7A\nGene ID (NCBI): 7476\nRRID: AB_3085932\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O00755\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869627994281,"sku":"27177-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27177-1-ap","provider":"Iright","version":"1.0","type":"link"}