{"product_id":"proteintech-27185-1-ap","title":"Proteintech, 27185-1-AP, MSI1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MSI1 (27185-1-AP) by Proteintech is a Polyclonal antibody targeting MSI1 in WB, IHC, ELISA applications with reactivity to human samples\n27185-1-AP targets MSI1 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, Caco-2 cells,  HEK-293T cells\nPositive IHC detected in: human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMusashi1 (Msi1) is an RNA-binding protein expressed in neural progenitor cells and neural stem cells. The gene encoding human Msi1 encodes a 362 amino acid protein. In murine embryonic neural progenitor cells, Msi1 localizes to the cytoplasm and is downregulated during differentiation. Msi1 binds to NUMB, which encodes a membrane-associated antagonist of Notch signaling. Msi1 appears to function in the proliferation and maintenance of stem cell populations of the central nervous system. In addition to its usefulness as a marker for neural progenitor cells in normal human brains, Msi1 is also a marker for human gliomas. In rats, Msi1 is expressed in Sertoli cells of the testis and granulosa cells of the ovary.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26042 Product name: Recombinant human MSI1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-83 aa of BC146463 Sequence: METDAPQPGLASPDSPHDPCKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRH Predict reactive species\nFull Name: musashi homolog 1 (Drosophila)\nCalculated Molecular Weight: 362 aa, 39 kDa\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: BC146463\nGene Symbol: MSI1\nGene ID (NCBI): 4440\nRRID: AB_2880790\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O43347\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869416804521,"sku":"27185-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27185-1-ap","provider":"Iright","version":"1.0","type":"link"}