{"product_id":"proteintech-27196-1-ap","title":"Proteintech, 27196-1-AP, PIM1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PIM1 (27196-1-AP) by Proteintech is a Polyclonal antibody targeting PIM1 in WB, ELISA applications with reactivity to human, mouse samples\n27196-1-AP targets PIM1 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: 3T3-L1 cells, LNCaP cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPIM1 belongs to the Ser\/Thr protein kinase family and the Pim subfamily. This family includes PIM1, PIM2, and PIM3, which share high sequence and structural similarity. PIM1 is a serine\/threonine protein kinase that significantly promotes cell survival and proliferation, providing a selective advantage for tumorigenesis. PIM1 is expressed primarily in cells of the hematopoietic and germline lineages (PMID: 16186805).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25743 Product name: Recombinant human PIM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 244-313 aa of BC020224 Sequence: HDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK Predict reactive species\nFull Name: pim-1 oncogene\nCalculated Molecular Weight: 45 kDa\nObserved Molecular Weight: 30-40 kDa\nGenBank Accession Number: BC020224\nGene Symbol: PIM1\nGene ID (NCBI): 5292\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P11309\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887762821289,"sku":"27196-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27196-1-ap","provider":"Iright","version":"1.0","type":"link"}