{"product_id":"proteintech-27212-1-ap","title":"Proteintech, 27212-1-AP, TGFBR2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TGFBR2 (27212-1-AP) by Proteintech is a Polyclonal antibody targeting TGFBR2 in WB, IHC, ELISA applications with reactivity to human samples\n27212-1-AP targets TGFBR2 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, MCF-7 cells,  COLO320 cells\nPositive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTGF beta Receptor II (TGFBR2) is a member of the transforming growth factor-β (TGF-β) superfamily, which are critical regulators of cell proliferation and differentiation, developmental patterning and morphogenesis, and disease pathogenesis (PMID: 10974075). TGFBR2 result in both SMAD4-dependent constraint of proliferation and SMAD4-independent activation of apoptosis (PMID: 29396446). The calculated molecular weight of TGFBR2 is 65 kDa. It has some isoforms with the molecular weight of 70-80 kDa and ~90 kDa after glycosylated.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat, sheep\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25767 Product name: Recombinant human TGFBR2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 23-166 aa of BC040499 Sequence: TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPDLLLVIFQ Predict reactive species\nFull Name: transforming growth factor, beta receptor II (70\/80kDa)\nCalculated Molecular Weight: 65 kDa\nObserved Molecular Weight: 65-80 kDa\nGenBank Accession Number: BC040499\nGene Symbol: TGFBR2\nGene ID (NCBI): 7048\nRRID: AB_2918119\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P37173\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868930724009,"sku":"27212-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27212-1-ap","provider":"Iright","version":"1.0","type":"link"}