{"product_id":"proteintech-27217-1-ap","title":"Proteintech, 27217-1-AP, USP40 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe USP40 (27217-1-AP) by Proteintech is a Polyclonal antibody targeting USP40 in WB, IHC, ELISA applications with reactivity to human samples\n27217-1-AP targets USP40 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells,  MCF-7 cells,  PC-3 cells\nPositive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUSP40 (ubiquitin specific peptidase 40), also known as ubiquitin thioesterase 40, deubiquitinating enzyme 40 or ubiquitin carboxyl-terminal hydrolase 40, is a 1235 amino acid protein that belongs to a large family of cysteine proteases that function as deubiquitinating enzymes. USP40 transcript is ubiquitously expressed but abundant in the kidney, heart, spleen, liver, and testis. Within the kidney, USP40 is expressed in glomerular endothelial cells during development (PMID:28148530).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25976 Product name: Recombinant human USP40 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1161-1235 aa of BC013305 Sequence: GDTIGVKNLLIDDDDDFSTIRDDTGKEKQKQRALGRRKSQEALHEQSSYILSSAETPARPRAPETSLSIHVGSFR Predict reactive species\nFull Name: ubiquitin specific peptidase 40\nObserved Molecular Weight: 140 kDa\nGenBank Accession Number: BC013305\nGene Symbol: USP40\nGene ID (NCBI): 55230\nRRID: AB_3085938\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NVE5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887918665897,"sku":"27217-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27217-1-ap","provider":"Iright","version":"1.0","type":"link"}