{"product_id":"proteintech-27223-1-ap","title":"Proteintech, 27223-1-AP, ELMO2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ELMO2 (27223-1-AP) by Proteintech is a Polyclonal antibody targeting ELMO2 in IP, ELISA applications with reactivity to human samples\n27223-1-AP targets ELMO2 in IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IP detected in: HEK-293 cells, BT-549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nELMO2 (Engulfment and cell motility protein 2), a member of the Elmo protein family, has been implicated in the regulation of Rac1 and Akt activation. ELMO2 is recruited to the plasma membrane and involved in the signaling cascade that controls cytoskeleton dynamics and cell migration (PMID: 27226625). ELMO2 is a cytoskeletal adaptor protein necessary for cell migration and apoptotic cell removal. Loss-of-function mutations in ELMO2, via impaired RAC1 signaling and defective vascular smooth muscles, as the causative factor for autosomal-recessive VMOS (PMID: 27476657).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25832 Product name: Recombinant human ELMO2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-60 aa of BC000143 Sequence: MERTQSSNMETRLDAMKELAKLSADVTFATEFINMDGIIVLTRLVESGTKLLSHYSEMLA Predict reactive species\nFull Name: engulfment and cell motility 2\nCalculated Molecular Weight: 80 kDa\nObserved Molecular Weight: 83 kDa\nGenBank Accession Number: BC000143\nGene Symbol: ELMO2\nGene ID (NCBI): 63916\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96JJ3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887503069353,"sku":"27223-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27223-1-ap","provider":"Iright","version":"1.0","type":"link"}