{"product_id":"proteintech-27225-1-ap","title":"Proteintech, 27225-1-AP, CACNA1E Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CACNA1E (27225-1-AP) by Proteintech is a Polyclonal antibody targeting CACNA1E in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n27225-1-AP targets CACNA1E in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat brain tissue\nPositive IHC detected in: human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCACNA1E is a gene encoding the ion-conducting α1 subunit of R-type voltage-dependent calcium channels, genetic variability of CACNA1E is associated to risk of type 2 diabetes, insulin resistance and impaired insulin secretion in nondiabetic subjects.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25944 Product name: Recombinant human CACNA1E protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 801-900 aa of NM_000721 Sequence: MEAPTMNPLNPLNPLSSLNPLNAHPSLYRRPRAIEGLALGLALEKFEEERISRGGSLKGDGGDRSSALDNQRTPLSLGQREPPWLARPCHGNCDPTQQEAG Predict reactive species\nFull Name: calcium channel, voltage-dependent, R type, alpha 1E subunit\nCalculated Molecular Weight: 262 kDa\nObserved Molecular Weight: 240 kDa\nGenBank Accession Number: NM_000721\nGene Symbol: CACNA1E\nGene ID (NCBI): 777\nRRID: AB_2880808\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q15878\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869520515241,"sku":"27225-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27225-1-ap","provider":"Iright","version":"1.0","type":"link"}