{"product_id":"proteintech-27245-1-ap","title":"Proteintech, 27245-1-AP, ECE1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ECE1 (27245-1-AP) by Proteintech is a Polyclonal antibody targeting ECE1 in WB, ELISA applications with reactivity to human samples\n27245-1-AP targets ECE1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HUVEC cells,  MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nECE1, Endothelin-converting enzyme 1, also known as ECE. It is located in cell membrane, and it has 4 isoforms. All isoforms are expressed in umbilical vein endothelial cells, polynuclear neutrophils, fibroblasts, atrium cardiomyocytes and ventricles. Isoforms A, B and C are also expressed in placenta, lung, heart, adrenal gland and phaeochromocytoma; isoforms A and C in liver, testis and small intestine; isoform B, C and D in endothelial cells and umbilical vein smooth muscle cells; isoforms C and D in saphenous vein cells, and isoform C in kidney (PMID: 9396733). The protein encoded by this gene is involved in proteolytic processing of endothelin precursors to biologically active peptides. Mutations in this gene are associated with Hirschsprung disease, cardiac defects and autonomic dysfunction. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. The calculated molecular weight of ECE1 is 87 kDa, as a result of glycosylation, the apparent molecular mass of ECE1 is approximately 87-110 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26124 Product name: Recombinant human ECE1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 90-189 aa of BC126257 Sequence: QYQTRSPSVCLSEACVSVTSSILSSMDPTVDPCHDFFSYACGGWIKANPVPDGHSRWGTFSNLWEHNQAIIKHLLENSTASVSEAERKAQVYYRACMNET Predict reactive species\nFull Name: endothelin converting enzyme 1\nObserved Molecular Weight: 87-110 kDa\nGenBank Accession Number: BC126257\nGene Symbol: ECE1\nGene ID (NCBI): 1889\nRRID: AB_3085941\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P42892\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887412662441,"sku":"27245-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27245-1-ap","provider":"Iright","version":"1.0","type":"link"}