{"product_id":"proteintech-27249-1-ap","title":"Proteintech, 27249-1-AP, Neurofibromin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Neurofibromin 1 (27249-1-AP) by Proteintech is a Polyclonal antibody targeting Neurofibromin 1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n27249-1-AP targets Neurofibromin 1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  HEK-293T cells\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: mouse brain tissue, human liver tissue,  human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNF1 codes for neurofibromin,  a GTPase-activating protein that negatively regulates RAS\/MAPK pathway activity by accelerating the hydrolysis of Ras-bound GTP. NF1 has a high mutation rate and mutations in NF1 can alter cellular growth control, and neural development, resulting in neurofibromatosis type 1 (NF1, also known as von Recklinghausen syndrome).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25799 Product name: Recombinant human Neurofibromin protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-100 aa of M60915 Sequence: MAAHRPVEWVQAVVSRFDEQLPIKTGQQNTHTKVSTEHNKECLINISKYKFSLVISGLTTILKNVNNMRIFGEAAEKNLYLSQLIILDTLEKCLAGQPKD Predict reactive species\nFull Name: neurofibromin 1\nCalculated Molecular Weight: 319 kDa\nObserved Molecular Weight: 250-280 kDa\nGenBank Accession Number: M60915\nGene Symbol: Neurofibromin 1\nGene ID (NCBI): 4763\nRRID: AB_2880818\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P21359\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868970832041,"sku":"27249-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27249-1-ap","provider":"Iright","version":"1.0","type":"link"}