{"product_id":"proteintech-27250-1-ap","title":"Proteintech, 27250-1-AP, DLEU7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DLEU7 (27250-1-AP) by Proteintech is a Polyclonal antibody targeting DLEU7 in WB, ELISA applications with reactivity to human, mouse, rat samples\n27250-1-AP targets DLEU7 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue, rat testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDLEU7 (Deleted in Lymphocytic Leukemia 7) is a tumor suppressor protein, frequently inactivated in B-cell chronic lymphocytic leukemia (CLL). This 221-amino-acid protein functions as a critical negative regulator of NF-κB signaling by directly inhibiting TACI and BCMA, key transducers of B-cell proliferative signals. Through this mechanism, DLEU7 suppresses cell proliferation and induces apoptosis. DLEU7 represents a potential therapeutic target in CLL and other B-cell malignancies (PMID: 34277865; 35892027).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24414 Product name: Recombinant human DLEU7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-91 aa of BC104892 Sequence: MASPAPLVASISHQMVALQTLQLLQQEWGWGDGPVAPGNPRDPDHVSTAPARRSGPPRARPGPGREERGGGVGTRSRRTAARVNSPEEEVV Predict reactive species\nFull Name: deleted in lymphocytic leukemia, 7\nCalculated Molecular Weight: 221aa,24 kDa; 160aa,17 kDa\nObserved Molecular Weight: 17-24 kDa\nGenBank Accession Number: BC104892\nGene Symbol: DLEU7\nGene ID (NCBI): 220107\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6UYE1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887201800361,"sku":"27250-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27250-1-ap","provider":"Iright","version":"1.0","type":"link"}