{"product_id":"proteintech-27251-1-ap","title":"Proteintech, 27251-1-AP, RBL2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RBL2 (27251-1-AP) by Proteintech is a Polyclonal antibody targeting RBL2 in WB, ELISA applications with reactivity to human samples\n27251-1-AP targets RBL2 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells,  Raji cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRBL2, also named as Retinoblastoma-like protein 2 or p130, is a 1130 amino acid protein, which Belongs to the retinoblastoma protein (RB) family. RBL2 is a Key regulator of entry into cell division and is directly involved in heterochromatin formation by maintaining overall chromatin structure and, in particular, that of constitutive heterochromatin by stabilizing histone methylation. RBL2 recruits and targets histone methyltransferases KMT5B and KMT5C, leading to epigenetic transcriptional repression and controls histone H4 'Lys-20' trimethylation. RBL2 probably acts as a transcription repressor by recruiting chromatin-modifying enzymes to promoters. RBL2 may act as a tumor suppressor.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25087 Product name: Recombinant human RBL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-85 aa of BC034490 Sequence: MPSGGDQSPPPPPPPPAAAASDEEEEDDGEAEDAAPPAESPTPQIQQRFDELCSRLNMDEAARAEAWDSYRSMSESYTLEGNDLH Predict reactive species\nFull Name: retinoblastoma-like 2 (p130)\nCalculated Molecular Weight: 130 kDa\nObserved Molecular Weight: 128 kDa\nGenBank Accession Number: BC034490\nGene Symbol: RBL2\nGene ID (NCBI): 5934\nRRID: AB_2880819\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q08999\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869008515241,"sku":"27251-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27251-1-ap","provider":"Iright","version":"1.0","type":"link"}