{"product_id":"proteintech-27260-1-ap","title":"Proteintech, 27260-1-AP, Occludin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Occludin (27260-1-AP) by Proteintech is a Polyclonal antibody targeting Occludin in WB, IHC, IF\/ICC, IF-Fro, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n27260-1-AP targets Occludin in WB, IHC, IF\/ICC, IF-Fro, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HUVEC cells, mouse kidney tissue,  mouse brain tissue,  mouse colon tissue,  mouse liver tissue,  rat liver tissue,  rat brain tissue\nPositive IP detected in: HUVEC cells\nPositive IHC detected in: human colon tissue, human breast cancer tissue,  human kidney tissue,  mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-Fro detected in: mouse brain tissue\nPositive IF\/ICC detected in: Caco-2 cells, MCF-7 cells\nPositive FC (Intra) detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:1000-1:10000\nImmunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:250-1:1000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nOccludin is an integral membrane protein located at the tight junction. It is a tetraspanin protein with four transmembrane domains, intracellular N and C termini, and two extracellular loops. Occludin plays a role in the formation and regulation of the tight junction paracellular permeability barrier. Occludin can exist in different isoforms, owing to modifications at the posttranscriptional and posttranslational levels, the monomeric occludin migrates as 53-65 kDa on SDS-PAGE (PMID: 22083955; 19457074).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig, rabbit, canine, chicken, bovine, goat, duck\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26173 Product name: Recombinant human Occludin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 360-522 aa of BC029886 Sequence: VDDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYETDYTTGGESCDELEEDWIREYPPITSDQQRQLYKRNFDTGLQEYKSLQSELDEINKELSRLDKELDDYREESEEYMAAADEYNRLKQVKGSADYKSKKNHCKQLKSKLSHIKKMVGDYDRQKT Predict reactive species\nFull Name: occludin\nCalculated Molecular Weight: 522 aa, 59 kDa\nObserved Molecular Weight: 59 kDa, 53 kDa, 32 kDa, 23-25 kDa\nGenBank Accession Number: BC029886\nGene Symbol: Occludin\nGene ID (NCBI): 4950\nRRID: AB_2880820\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q16625\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868818067625,"sku":"27260-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27260-1-ap","provider":"Iright","version":"1.0","type":"link"}