{"product_id":"proteintech-27285-1-ap","title":"Proteintech, 27285-1-AP, PPP1R3B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PPP1R3B (27285-1-AP) by Proteintech is a Polyclonal antibody targeting PPP1R3B in WB, IHC, ELISA applications with reactivity to human, mouse samples\n27285-1-AP targets PPP1R3B in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, MDA-MB-453s cells\nPositive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPPP1R3B, also known as Protein Phosphatase 1, Regulatory Subunit 3B, is a protein encoded by the PPP1R3B gene in humans. It is a regulatory subunit of the serine\/threonine-specific protein phosphatase 1 (PP1), an enzyme that plays a crucial role in the control of a wide range of cellular processes by dephosphorylating target proteins.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26025 Product name: Recombinant human PPP1R3B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 139-259 aa of BC043388 Sequence: VLKDKAIAGTVKVQNLAFEKTVKIRMTFDTWKSYTDFPCQYVKDTYAGSDRDTFSFDISLPEKIQSYERMEFAVYYECNGQTYWDSNRGKNYRIIRAELKSTQGMTKPHSGPDLGISFDQF Predict reactive species\nFull Name: protein phosphatase 1, regulatory (inhibitor) subunit 3B\nCalculated Molecular Weight: 33 kDa\nObserved Molecular Weight: 33 kDa\nGenBank Accession Number: BC043388\nGene Symbol: PPP1R3B\nGene ID (NCBI): 79660\nRRID: AB_2880829\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q86XI6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887770587305,"sku":"27285-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27285-1-ap","provider":"Iright","version":"1.0","type":"link"}