{"product_id":"proteintech-27286-1-ap","title":"Proteintech, 27286-1-AP, BCRP\/ABCG2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BCRP\/ABCG2 (27286-1-AP) by Proteintech is a Polyclonal antibody targeting BCRP\/ABCG2 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n27286-1-AP targets BCRP\/ABCG2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, HEK-293 cells,  MCF-7 cells,  SGC-7901 cells,  mouse brain tissue\nPositive IHC detected in: human liver cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBCRP (breast cancer resistance protein) confers a broad spectrum of drug resistance and the expression of BCRP is enhanced in several cancer cell models. It has ATPase activity and belongs to a family of multiple drug resistant proteins. Data also indicated that BCRP might be an early marker for some stem cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat, canine\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25911 Product name: Recombinant human BCRP,ABCG2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 557-630 aa of BC021281 Sequence: NLTTIASWLSWLQYFSIPRYGFTALQHNEFLGQNFCPGLNATGNNPCNYATCTGEEYLVKQGIDLSPWGLWKNH Predict reactive species\nFull Name: ATP-binding cassette, sub-family G (WHITE), member 2\nCalculated Molecular Weight: 70 kDa\nObserved Molecular Weight: 68-72 kDa\nGenBank Accession Number: BC021281\nGene Symbol: ABCG2\nGene ID (NCBI): 9429\nRRID: AB_2880830\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UNQ0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868834418857,"sku":"27286-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27286-1-ap","provider":"Iright","version":"1.0","type":"link"}