{"product_id":"proteintech-27292-1-ap","title":"Proteintech, 27292-1-AP, NRG4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NRG4 (27292-1-AP) by Proteintech is a Polyclonal antibody targeting NRG4 in IHC, ELISA applications with reactivity to human samples\n27292-1-AP targets NRG4 in IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human prostate cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNeuregulin 4 (Nrg4), a member of the epidermal growth factor (EGF) family of extracellular ligands, is expressed in multiple organs with the highest expression levels in brown adipose tissue. Neuregulin 4 is a secreted adipokine recently identified as playing an important role in modulating systemic energy metabolism and in the development of metabolic disorders in rodent and human obesity, including type 2 diabetes and non-alcoholic fatty liver disease (NAFLD). Nrg4 attenuates hepatic lipogenic signaling and preserves glucose and lipid homeostasis in obesity.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26044 Product name: Recombinant human NRG4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-62 aa of BC017568 Sequence: MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSNLF Predict reactive species\nFull Name: neuregulin 4\nCalculated Molecular Weight: 13 kDa\nGenBank Accession Number: BC017568\nGene Symbol: NRG4\nGene ID (NCBI): 145957\nRRID: AB_3669591\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8WWG1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887742341289,"sku":"27292-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27292-1-ap","provider":"Iright","version":"1.0","type":"link"}