{"product_id":"proteintech-27303-1-ap","title":"Proteintech, 27303-1-AP, VAChT Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe VAChT (27303-1-AP) by Proteintech is a Polyclonal antibody targeting VAChT in WB, ELISA applications with reactivity to human, mouse, rat samples\n27303-1-AP targets VAChT in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC18A3 also known as VAChT, is the vesicular amine transporter family member. The SLC18A3 gene encodes a transmembrane protein that transports acetylcholine (ACh) into presynaptic secretory vesicles for release at cholinergic nerve endings in the central and peripheral nervous systems. Mutations in SLC18A3 are associated with congenital myasthenic syndrome(PMID: 27590285). The 68-70 kDa mature glycosylated form of VAChT can be detected (PMID: 14705140).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25153 Product name: Recombinant human SLC18A3 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 410-501 aa of BC007765 Sequence: DVRHVSVYGSVYAIADISYSVAYALGPIVAGHIVHSLGFEQLSLGMGLANLLYAPVLLLLRNVGLLTRSRSERDVLLDEPPQGLYDAVRLRE Predict reactive species\nFull Name: solute carrier family 18 (vesicular acetylcholine), member 3\nCalculated Molecular Weight: 532 aa, 57 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC007765\nGene Symbol: VAChT\nGene ID (NCBI): 6572\nRRID: AB_3669592\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q16572\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887919550633,"sku":"27303-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27303-1-ap","provider":"Iright","version":"1.0","type":"link"}