{"product_id":"proteintech-27310-1-ap","title":"Proteintech, 27310-1-AP, EDEM3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EDEM3 (27310-1-AP) by Proteintech is a Polyclonal antibody targeting EDEM3 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples\n27310-1-AP targets EDEM3 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: 3T3-L1 cells, HEK-293 cell\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26123 Product name: Recombinant human EDEM3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-80 aa of BC016464 Sequence: DNAASISPSEQTSNPTENHETTNLNGECTDLDNQLQEQSETEEDSNPNVSWGKKVQPIDSILADWNEDIEAFEMMEKDEL Predict reactive species\nFull Name: ER degradation enhancer, mannosidase alpha-like 3\nCalculated Molecular Weight: 105 kDa\nObserved Molecular Weight: 100-110 kDa\nGenBank Accession Number: BC016464\nGene Symbol: EDEM3\nGene ID (NCBI): 80267\nRRID: AB_2880839\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BZQ6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887420002473,"sku":"27310-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27310-1-ap","provider":"Iright","version":"1.0","type":"link"}