{"product_id":"proteintech-27343-1-ap","title":"Proteintech, 27343-1-AP, SOCS6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SOCS6 (27343-1-AP) by Proteintech is a Polyclonal antibody targeting SOCS6 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples\n27343-1-AP targets SOCS6 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, Calu-1 cells,  NIH\/3T3 cells,  human placenta tissue\nPositive IP detected in: NIH\/3T3 cells, human placenta tissue\nPositive IHC detected in: human colon tissue, mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSOCS6 (Suppressor of cytokine signaling 6) is also named as CIS4 and SOCS4. SOCS6 is one of eight members of the SOCS family of proteins. SOCS6 is involved in negative regulation of receptor signaling by increasing degradation mediated by ubiquitination of receptors or substrate proteins and induces apoptosis by targeting mitochondrial proteins (PMID: 25172101). SOCS6 is widely expressed in many tissues and is found to be downregulated in many cancers including colorectal cancer, gastric cancer, lung cancer, ovarian cancer, stomach cancer, thyroid cancer, hepatocellular carcinoma, and pancreatic cancer (PMID: 25172101). In addition to its molecular weight of 60 kDa, SOCS6 has a 70 kDa isoform (PMID: 34169835, PMID: 22125600).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25594 Product name: Recombinant human SOCS6 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 132-385 aa of BC020082 Sequence: YSPAPWPLRPTNSEETCIKMEVRVKALVHSSSPSPALNGVRKDFHDLQSETTCQEQANSLKSSASHNGDLHLHLDEHVPVVIGLMPQDYIQYTVPLDEGMYPLEGSRSYCLDSSSPMEVSAVPPQVGGRAFPEDESQVDQDLVVAPEIFVDQSVNGLLIGTTGVMLQSPRAGHDDVPPLSPLLPPMQNNQIQRNFSGLTGTEAHVAESMRCHLNFDPNSAPGVARVYDSVQSSGPMVVTSLTEELKKLAKQGWY Predict reactive species\nFull Name: suppressor of cytokine signaling 6\nCalculated Molecular Weight: 60 kDa\nObserved Molecular Weight: 60-75 kDa\nGenBank Accession Number: BC020082\nGene Symbol: SOCS6\nGene ID (NCBI): 9306\nRRID: AB_3669595\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O14544\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887811973289,"sku":"27343-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27343-1-ap","provider":"Iright","version":"1.0","type":"link"}