{"product_id":"proteintech-27344-1-ap","title":"Proteintech, 27344-1-AP, RARS Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RARS (27344-1-AP) by Proteintech is a Polyclonal antibody targeting RARS in WB, IP, IHC, ELISA applications with reactivity to human samples\n27344-1-AP targets RARS in WB, IHC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, A431 cells,  U-251 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human heart tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRARS, also named ArgRS (arginyl-tRNA synthetase), belongs to the class-I aminoacyl-tRNA synthetase family which catalyze the aminoacylation of tRNA by their cognate amino acid. In higher eukaryotes, one of the two arginyl-tRNA synthetases (ArgRSs) has evolved to have an extended N-terminal domain that plays a crucial role in protein synthesis and cell growth and in integration into the multisynthetase complex (MSC) (PMID:25288775). RARS has two isoforms with the molecular weight of 75 and 67 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26390 Product name: Recombinant human RARS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-190 aa of BC000528 Sequence: MDVLVSECSARLLQQEEEIKSLTAEIDRLKNCGCLGASPNLEQLQEENLKLKYRLNILRKSLQAERNKPTKNMINIISRLQEVFGHAIKAAYPDLENPPLLVTPSQQAKFGDYQCNSAMGISQMLKTKEQKVNPREIAENITKHLPDNECIEKVEIAGPGFINVHLRKDFVSEQLTSLLVNGVQLPALGE Predict reactive species\nFull Name: arginyl-tRNA synthetase\nCalculated Molecular Weight: 75 kDa\nObserved Molecular Weight: 67 kDa\nGenBank Accession Number: BC000528\nGene Symbol: RARS\nGene ID (NCBI): 5917\nRRID: AB_2880849\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P54136\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869008416937,"sku":"27344-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27344-1-ap","provider":"Iright","version":"1.0","type":"link"}