{"product_id":"proteintech-27359-1-ap","title":"Proteintech, 27359-1-AP, SEMA4A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SEMA4A (27359-1-AP) by Proteintech is a Polyclonal antibody targeting SEMA4A in WB, IHC, ELISA applications with reactivity to human samples\n27359-1-AP targets SEMA4A in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, PC-3 cells\nPositive IHC detected in: human breast cancer tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSema4A, the membrane-bound class 4 semaphorin, belongs to semaphorins superfamily. Sema4A funtions as potent axonal repellants in the nervous system, and is involved in vascular development. Two species of Sema4A with molecular weights of about 150 and 120 kDa were observed. The antibody recognizes the Sema4A protein, which is of appropriate molecular size (~120 kDa) for the glycosylated protein(PMID: 26296689\/17318185\/26024919).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26023 Product name: Recombinant human SEMA4A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 96-330 aa of BC020974 Sequence: RLKNMIPWPASDRKKSECAFKKKSNETQCFNFIRVLVSYNVTHLYTCGTFAFSPACTFIELQDSYLLPISEDKVMEGKGQSPFDPAHKHTAVLVDGMLYSGTMNNFLGSEPILMRTLGSQPVLKTDNFLRWLHHDASFVAAIPSTQVVYFFFEETASEFDFFERLHTSRVARVCKNDVGGEKLLQKKWTTFLKAQLLCTQPGQLPFNVIRHAVLLPADSPTAPHIYAVFTSQWQV Predict reactive species\nFull Name: sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4A\nCalculated Molecular Weight: 761 aa, 84 kDa\nObserved Molecular Weight: 120-150 kDa\nGenBank Accession Number: BC020974\nGene Symbol: SEMA4A\nGene ID (NCBI): 64218\nRRID: AB_2880854\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H3S1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869595259049,"sku":"27359-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27359-1-ap","provider":"Iright","version":"1.0","type":"link"}