{"product_id":"proteintech-27360-1-ap","title":"Proteintech, 27360-1-AP, TACSTD2\/TROP2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TACSTD2\/TROP2 (27360-1-AP) by Proteintech is a Polyclonal antibody targeting TACSTD2\/TROP2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n27360-1-AP targets TACSTD2\/TROP2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HaCaT cells\nPositive IHC detected in: human breast cancer tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HaCaT cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2400\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTrophoblast cell surface antigen 2 (TROP2), also named as TACSTD2, is a transmembrane glycoprotein. TROP2 plays a role in transducing intracellular calcium signals. It is expressed in trophoblast cells, cornea and multi-stratified epithelia. TROP2 is overexpressed in most carcinomas and is involved in cancer proliferation, migration, invasion, and metastasis. Congenital mutations of TROP2 cause a rare autosomal recessive disease which  may lead to blindness-the gelatinous drop-like corneal disease  (PMID: 35688908).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25769 Product name: Recombinant human TACSTD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 138-215 aa of BC009409 Sequence: KGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAG Predict reactive species\nFull Name: tumor-associated calcium signal transducer 2\nCalculated Molecular Weight: 36 kDa\nObserved Molecular Weight: 45-55 kDa\nGenBank Accession Number: BC009409\nGene Symbol: TROP2\nGene ID (NCBI): 4070\nRRID: AB_2918122\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P09758\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869610922153,"sku":"27360-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27360-1-ap","provider":"Iright","version":"1.0","type":"link"}