{"product_id":"proteintech-27363-1-ap","title":"Proteintech, 27363-1-AP, CHI3L2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CHI3L2 (27363-1-AP) by Proteintech is a Polyclonal antibody targeting CHI3L2 in WB, ELISA applications with reactivity to human samples\n27363-1-AP targets CHI3L2 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, U-87 MG cells,  NCCIT cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCHI3L2 (Chitinase-3-Like Protein 2), also known as YKL-39, is a member of the chitinase-like protein family, which belongs to the glycoside hydrolase 18 family. CHI3L2 is primarily involved in cartilage biogenesis and tissue remodeling. It is highly expressed in certain tissues, including the appendix and salivary glands.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26386 Product name: Recombinant human CHI3L2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 37-174 aa of BC011460 Sequence: SQDRQEPGKFTPENIDPFLCSHLIYSFASIENNKVIIKDKSEVMLYQTINSLKTKNPKLKILLSIGGYLFGSKGFHPMVDSSTSRLEFINSIILFLRNHNFDGLDVSWIYPDQKENTHFTVLIHELAEAFQKDFTKST Predict reactive species\nFull Name: chitinase 3-like 2\nCalculated Molecular Weight: 390 aa, 44 kDa\nObserved Molecular Weight: 44-48 kDa\nGenBank Accession Number: BC011460\nGene Symbol: CHI3L2\nGene ID (NCBI): 1117\nRRID: AB_3669597\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q15782\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886516654249,"sku":"27363-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27363-1-ap","provider":"Iright","version":"1.0","type":"link"}