{"product_id":"proteintech-27391-1-ap","title":"Proteintech, 27391-1-AP, PPAP2B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PPAP2B (27391-1-AP) by Proteintech is a Polyclonal antibody targeting PPAP2B in WB, ELISA applications with reactivity to human, mouse samples\n27391-1-AP targets PPAP2B in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: U-87 MG cells, human placenta tissue,  mouse cerebellum tissue,  mouse lung tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPhosphatidic acid phosphatase type 2B (PPAP2B), also known as Lipid phosphate phosphatase 3 (LPP3), is a member of the phosphatidic acid phosphatase (PAP) family. PPAP2B is an integral membrane protein that inactivates lysophosphatidic acid, was implicated in coronary artery disease (CAD) by genomewide association studies (PMID: 26034042). PPAP2B can be detected at least two immunoreactive bands with different mobility, ranging from 36 to 50 kDa, which may reflect oligomer formation and\/or post-translational protein modifications, such as glycosylation (PMID: 28364255).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26422 Product name: Recombinant human PPAP2B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-120 aa of BC009196 Sequence: MQNYKYDKAIVPESKNGGSPALNNNPRRSGSKRVLLICLDLFCLFMAGLPFLIIETSTIKPYHRGFYCNDESIKYPLKTGETINDAVLCAVGIVIAILAIITGEFYRIYYLKKSRSTIQN Predict reactive species\nFull Name: phosphatidic acid phosphatase type 2B\nCalculated Molecular Weight: 35 kDa\nObserved Molecular Weight: 30-40 kDa\nGenBank Accession Number: BC009196\nGene Symbol: PPAP2B\nGene ID (NCBI): 8613\nRRID: AB_3669598\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O14495\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869733343401,"sku":"27391-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27391-1-ap","provider":"Iright","version":"1.0","type":"link"}