{"product_id":"proteintech-27415-1-ap","title":"Proteintech, 27415-1-AP, THEMIS Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe THEMIS (27415-1-AP) by Proteintech is a Polyclonal antibody targeting THEMIS in WB, IHC, ELISA applications with reactivity to human, mouse samples\n27415-1-AP targets THEMIS in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells\nPositive IHC detected in: human tonsillitis tissue, mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe T cell lineage-restricted protein THEMIS, also called C6orf190 and C6orf207, plays a critical role in T cell development at the positive selection stage (PMID: 37159521). THEMIS plays a central role in late thymocyte development by controlling both positive and negative T-cell selection. It is required to sustain and\/or integrate signals required for proper lineage commitment and maturation of T-cells and regulates T-cell development through T-cell antigen receptor (TCR) signaling (PMID: 28697966, 28250424). It can also promote the proliferative response of CD8+ T cells to low-affinity ligands (PMID: 31932808).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26387 Product name: Recombinant human TSEPA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 61-222 aa of BC130516 Sequence: AEICEQIEGCESLQPFELPMNFPGLFKIVADKTPYLTMEEITRTIHIGPSRLGHPCFYHQKDIKLENLIIKQGEQIMLNSVEEIDGEIMVSCAVARNHQTHSFNLPLSQEGEFYECEDERIYTLKEIVEWKIPKNRTRTVNLTDFSNKWDSTNPFPKDFYGT Predict reactive species\nFull Name: thymocyte selection pathway associated\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC130516\nGene Symbol: THEMIS\nGene ID (NCBI): 387357\nRRID: AB_2880866\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N1K5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869776924841,"sku":"27415-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27415-1-ap","provider":"Iright","version":"1.0","type":"link"}