{"product_id":"proteintech-27433-1-ap","title":"Proteintech, 27433-1-AP, TUBD1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TUBD1 (27433-1-AP) by Proteintech is a Polyclonal antibody targeting TUBD1 in WB, ELISA applications with reactivity to human samples\n27433-1-AP targets TUBD1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTUBD1, also named as TUBD, Tubulin delta chain, tubulin delta 1. The TUBD1 gene encodes a centrosomal protein of 453-amino acids with a molecular mass of 51 kD containing the canonical GTP-binding domain shared with other tubulins. TUBD1 mRNA is preferentially expressed in the sperm head, but it has been also detected in retina, heart, muscle, thyroid, ovary, and colon, among other tissues. At least 6 isoforms of the human protein are produced by alternative splicing (PMID: 28137601). The molecular weights of these 6 isoforms are 51, 45, 22, 27, 44, and 40 kDa, respectively.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26626 Product name: Recombinant human TUBD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-134 aa of BC000258 Sequence: LSDSHSSQGLCSMRENEAYQASCKERFFSEEENGVPIARAVLVDMEPKVINQMLSKAAQSGQWKYGQHACFCQKQGSGNNWAYGYSVHGPRHEESIMNIIRKEVEKCDSFS Predict reactive species\nFull Name: tubulin, delta 1\nCalculated Molecular Weight: 51 kDa\nObserved Molecular Weight: 44 kda\nGenBank Accession Number: BC000258\nGene Symbol: TUBD1\nGene ID (NCBI): 51174\nRRID: AB_3669602\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UJT1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887911162025,"sku":"27433-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27433-1-ap","provider":"Iright","version":"1.0","type":"link"}