{"product_id":"proteintech-27435-1-ap","title":"Proteintech, 27435-1-AP, RAB34 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RAB34 (27435-1-AP) by Proteintech is a Polyclonal antibody targeting RAB34 in WB, IHC, ELISA applications with reactivity to human samples\n27435-1-AP targets RAB34 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, HeLa cells,  U2OS cells,  A549 cells\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRAB34, a Rab protein family member, is involved in repositioning of lysosomes, activation of micropinocytosis, and protein transport. RAB34 is aberrantly expressed in various cancers and exhibits oncogenic properties. Recently, Rab34 is identified as a ciliary protein. Rab34 is required for internal assembly of cilia but not for cilia built on the cell surface.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26696 Product name: Recombinant human RAB34 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 126-251 aa of BC016841 Sequence: QAIIIVFNLNDVASLEHTKQWLADALKENDPSSVLLFLTPAQYALMEKDALQVAQEMKAEYWAVSSLTGENVREFFFRVAALTFEANVLAELEKSGARRIGDVVRINSDDSNLYLTASKKKPTCCP Predict reactive species\nFull Name: RAB34, member RAS oncogene family\nCalculated Molecular Weight: 251 aa, 28 kDa\nObserved Molecular Weight: 29 kDa\nGenBank Accession Number: BC016841\nGene Symbol: RAB34\nGene ID (NCBI): 83871\nRRID: AB_2880870\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BZG1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868959821993,"sku":"27435-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27435-1-ap","provider":"Iright","version":"1.0","type":"link"}