{"product_id":"proteintech-27441-1-ap","title":"Proteintech, 27441-1-AP, CCL3\/MIP-1 alpha Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CCL3\/MIP-1 alpha (27441-1-AP) by Proteintech is a Polyclonal antibody targeting CCL3\/MIP-1 alpha in WB, ELISA applications with reactivity to human samples\n27441-1-AP targets CCL3\/MIP-1 alpha in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: THP-1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nChemokine (C-C motif) ligand 3 (CCL3), also known as MIP-1α, belongs to the family of chemokines. CCL3 has been found in the central nervous system and its cognate receptors, CCR1 and CCR5, have been reported to be expressed by astrocytes, microglia and neurons. CCL3 and its receptors, CCR1 and CCR5, also contribute to the development of bone disease in multiple myeloma by supporting tumor growth and regulating osteoclast differentiation. CCL3 is also associated with the regulation of cell growth, angiogenesis, and metastasis of different tumors such as melanoma, renal cell carcinoma, and colorectal cancer. Moreover, CCL3 enhances cell migration and metastasis by up-regulating matrix metalloproteinase-2 (MMP)-2 expression in chondrosarcoma cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26764 Product name: Recombinant human CCL3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-92 aa of BC071834 Sequence: SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA Predict reactive species\nFull Name: chemokine (C-C motif) ligand 3\nCalculated Molecular Weight: 92 aa, 10 kDa\nObserved Molecular Weight: 10 kDa\nGenBank Accession Number: BC071834\nGene Symbol: CCL3\/MIP-1 alpha\nGene ID (NCBI): 6348\nRRID: AB_3085961\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P10147\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886009372841,"sku":"27441-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27441-1-ap","provider":"Iright","version":"1.0","type":"link"}