{"product_id":"proteintech-27456-1-ap","title":"Proteintech, 27456-1-AP, PLCB2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PLCB2 (27456-1-AP) by Proteintech is a Polyclonal antibody targeting PLCB2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n27456-1-AP targets PLCB2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: THP-1 cells, HL-60 cells\nPositive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: THP-1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:300-1:1200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPLCB2 (1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2) is also named as PLC-beta-2. PLCB2 is a critical regulator of platelet responses upon activation (PMID: 27465150). NF-κB regulates expression of PLC-β2. The PLCB2 genes was found to be differentially expressed in human breast cancer MCF-7 cells, and to be associated with multidrug resistance (PMID: 2951275). The knockdown of PLCB2 suppressed cell viability and promoted cell apoptosis by activating the Ras\/Raf\/MAPK pathway. Thus, PLCB2 may utilized as a potential therapeutic target in patients with melanoma (PMID: 31746389).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25771 Product name: Recombinant human PLCB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC000939 Sequence: MSLLNPVLLPPKVKAYLSQGERFIKWDDETTVASPVILRVDPKGYYLYWTYQSKEMEFLDITSIRDTRFGKFAKMPKSQKLRDVFNMDFPDNSFLLKTLT Predict reactive species\nFull Name: phospholipase C, beta 2\nCalculated Molecular Weight: 134 kDa\nObserved Molecular Weight: 134 kDa\nGenBank Accession Number: BC000939\nGene Symbol: PLCB2\nGene ID (NCBI): 5330\nRRID: AB_3085963\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q00722\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887764721833,"sku":"27456-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27456-1-ap","provider":"Iright","version":"1.0","type":"link"}