{"product_id":"proteintech-27457-1-ap","title":"Proteintech, 27457-1-AP, RRAS Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RRAS (27457-1-AP) by Proteintech is a Polyclonal antibody targeting RRAS in WB, IP, IHC, ELISA applications with reactivity to human, mouse samples\n27457-1-AP targets RRAS in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, PC-3 cells,  HT-29 cells\nPositive IP detected in: HT-29 cells\nPositive IHC detected in: human renal cell carcinoma tissue, mouse kidney tissue,  mouse colon tissue,  human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26538 Product name: Recombinant human RRAS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 145-218 aa of BC016318 Sequence: DLESQRQVPRSEASAFGASHHVAYFEASAKLRLNVDEAFEQLVRAVRKYQEQELPPSPPSAPRKKGGGCPCVLL Predict reactive species\nFull Name: related RAS viral (r-ras) oncogene homolog\nCalculated Molecular Weight: 218 aa, 23 kDa\nObserved Molecular Weight: 23 kDa\nGenBank Accession Number: BC016318\nGene Symbol: RRAS\nGene ID (NCBI): 6237\nRRID: AB_2880876\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P10301\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868988330153,"sku":"27457-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27457-1-ap","provider":"Iright","version":"1.0","type":"link"}