{"product_id":"proteintech-27504-1-ap","title":"Proteintech, 27504-1-AP, PSMD8 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PSMD8 (27504-1-AP) by Proteintech is a Polyclonal antibody targeting PSMD8 in WB, IF\/ICC, ELISA applications with reactivity to Human, Mouse samples\n27504-1-AP targets PSMD8 in WB, IF\/ICC, ELISA applications and shows reactivity with Human, Mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NIH\/3T3 cells\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe Proteasome 26S Subunit, Non-ATPase (PSMD) gene family, which includes the PSMD1 to PSMD14, regulate ubiqutinated protein breakdown in circulation as well as tumorigenesis. Studies have shown that PSMD8 interacts with the sperm adhesin AQN1 to limit polyfertilization. PSMD8 was more expressed in normal skeletal muscle, cardiac muscle, and tongue muscle; among malignant tumors, PSMD8 was expressed in ovarian cancer, testicular cancer, glioma, and melanoma(PMID:37349676).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26567 Product name: Recombinant human PSMD8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-130 aa of BC001164 Sequence: MYEQLKGEWNRKSPNLSKCGEELGRLKLVLLELNFLPTTGTKLTKQQLILARDILEIGAQWSILRKDIPSFERYMAQLKCYYFDYKEQLPESAYMHQLLGLNLLFLLSQNRVAEFHTELERLPAKDIQTN Predict reactive species\nFull Name: proteasome (prosome, macropain) 26S subunit, non-ATPase, 8\nCalculated Molecular Weight: 257 aa, 30 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC001164\nGene Symbol: PSMD8\nGene ID (NCBI): 5714\nRRID: AB_3669605\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P48556\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869745467561,"sku":"27504-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27504-1-ap","provider":"Iright","version":"1.0","type":"link"}