{"product_id":"proteintech-27514-1-ap","title":"Proteintech, 27514-1-AP, LARP6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LARP6 (27514-1-AP) by Proteintech is a Polyclonal antibody targeting LARP6 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n27514-1-AP targets LARP6 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, mouse brain tissue\nPositive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLa-related protein 6 (LARP6), also known as Acheron or La ribonucleoprotein domain family member 6, is a protein encoded by the LARP6 gene in humans. It is a member of the LARP superfamily of RNA-binding proteins, which are post-transcriptional regulators. It is a phosphoprotein and eight phosphorylation sites have been identified. Six of these phosphorylation sites reside in the C-terminal domain of LARP6 (CTER). These sites are Ser348, Ser396, Ser409, Ser421, Ser447, and Ser451 (PMID: 27011170).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24354 Product name: Recombinant human LARP6 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 378-491 aa of BC009446 Sequence: CTSPWSSPLAQRKGVSRKSPLAEEGRLNCSTSPEIFRKCMDYSSDSSVTPSGSPWVRRRRQAEMGTQEKSPGTSPLLSRKMQTADGLPVGVLRLPRGPDNTRGFHGHERSRACV Predict reactive species\nFull Name: La ribonucleoprotein domain family, member 6\nCalculated Molecular Weight: 491 aa, 55 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC009446\nGene Symbol: LARP6\nGene ID (NCBI): 55323\nRRID: AB_3669606\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BRS8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887701643433,"sku":"27514-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27514-1-ap","provider":"Iright","version":"1.0","type":"link"}