{"product_id":"proteintech-27524-1-ap","title":"Proteintech, 27524-1-AP, Supervillin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Supervillin (27524-1-AP) by Proteintech is a Polyclonal antibody targeting Supervillin in WB, IHC, ELISA applications with reactivity to human, mouse samples\n27524-1-AP targets Supervillin in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, HepG2 cells\nPositive IHC detected in: mouse skeletal muscle tissue, mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSupervillin (SVIL) belongs to the villin\/gelsolin superfamily of actin-binding proteins involved in many cellular processes. A non-muscle-specific form of Supervillin activates androgen receptor activity. Supervillin another isoform, called Archvillin, is expressed in skeletal and cardiac muscle tissue where it plays a role in both muscle fiber structure and signaling. Mutations in Supervillin are associated with myofibrillar Myopathy10 (MFM10), which causes myopathy with myofibrillar disorganization and autophagic vacuoles(PMID: 9867483, 32779703).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26196 Product name: Recombinant human Supervillin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1679-1787 aa of NM_003174 Sequence: MFLDWTELKRSNEKNPGELAQHKEDPRTDVKAYDVTRMVSMPQTTAGTILDGVNVGRGYGLVEGHDRRQFEITSVSVDVWHILEFDYSRLPKQSIGQFHEGDAYVVKWKF Predict reactive species\nFull Name: supervillin\nCalculated Molecular Weight: 248 kDa\nObserved Molecular Weight: 205 kDa\nGenBank Accession Number: NM_003174\nGene Symbol: SVIL\nGene ID (NCBI): 6840\nRRID: AB_3669607\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95425\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887819509929,"sku":"27524-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27524-1-ap","provider":"Iright","version":"1.0","type":"link"}