{"product_id":"proteintech-27530-1-ap","title":"Proteintech, 27530-1-AP, ADAM32 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ADAM32 (27530-1-AP) by Proteintech is a Polyclonal antibody targeting ADAM32 in WB, ELISA applications with reactivity to human, mouse, rat samples\n27530-1-AP targets ADAM32 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue, rat testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nADAM32 may play a role in sperm development and fertilization and it is a non-catalytic metalloprotease-like protein. In mature sperm from cauda epididymis and vas deferens, a band of 44 kDa for ADAM32 is detected and indicates that ADAM32 is made as precursors and processed to lower molecular-weight forms during sperm maturation in the epididymis(PMID:16407499). The full length protein has a signal peptide, a propeptide and 4 glycosylation sites.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26450 Product name: Recombinant human ADAM32 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 704-787 aa of BC026169 Sequence: RKQLKKWFAKEEEFPSSESKSEGSTQTYASQSSSEGSTQTYASQTRSESSSQADTSKSKSEDSAEAYTSRSKSQDSTQTQSSSN Predict reactive species\nFull Name: ADAM metallopeptidase domain 32\nCalculated Molecular Weight: 787 aa, 88 kDa\nObserved Molecular Weight: 80 kDa\nGenBank Accession Number: BC026169\nGene Symbol: ADAM32\nGene ID (NCBI): 203102\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8TC27\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869802385577,"sku":"27530-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27530-1-ap","provider":"Iright","version":"1.0","type":"link"}