{"product_id":"proteintech-27543-1-ap","title":"Proteintech, 27543-1-AP, Livin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Livin (27543-1-AP) by Proteintech is a Polyclonal antibody targeting Livin in WB, IHC, ELISA applications with reactivity to Human samples\n27543-1-AP targets Livin in WB, IHC, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, A431 cells,  A375 cells,  HeLa cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBIRC7 also known as Livin, is one of the family members of the inhibitor of apoptosis protein (IAP). BIRC7 contains a BIR domain that has been shown to bind and inhibit caspases-3, −7 and −9, playing a key role in inhibiting apoptosis. Overexpression of BIRC7 in tumors has been linked with increased chemo- and radio-resistance, recurrence, and decreased patient survival. BIRC7 is closely associated with melanoma disease progression, apoptosis resistance, and chemotherapeutic drug resistance.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26737 Product name: Recombinant human BIRC7 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-216 aa of BC014475 Sequence: MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLRPLTEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLRSKGRDFVHSVQETHSQLLGSWDPWEEPEDAAPVAPSVPASGYPELPTPRREVQSESAQEP Predict reactive species\nFull Name: baculoviral IAP repeat-containing 7\nCalculated Molecular Weight: 33 kDa\nObserved Molecular Weight: 33 kDa\nGenBank Accession Number: BC014475\nGene Symbol: Livin\nGene ID (NCBI): 79444\nRRID: AB_2880901\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96CA5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869001797801,"sku":"27543-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27543-1-ap","provider":"Iright","version":"1.0","type":"link"}