{"product_id":"proteintech-27551-1-ap","title":"Proteintech, 27551-1-AP, SCN2A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SCN2A (27551-1-AP) by Proteintech is a Polyclonal antibody targeting SCN2A in WB, IF-P, ELISA applications with reactivity to human, mouse samples\n27551-1-AP targets SCN2A in WB, IF-P, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, mouse brain tissue,  mouse heart tissue\nPositive IF-P detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe Sodium Channel, Voltage-Gated, Type II, Alpha (SCN2A) gene encodes the neuronal sodium channel NaV1.2. There are two major developmentally regulated splice isoforms of NaV1.2 that use mutually exclusive copies of the fifth coding exon and differ by one amino acid at position 209: Asparagine (Asn\/N) vs. Aspartic acid (Asp\/D). NaV1.2 is one of several sodium channels involved in initiation and propagation of action potentials in neurons. It's widely expressed throughout the human central nervous system, but not in peripheral tissues. (PMID: 29691040)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26022 Product name: Recombinant human SCN2A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 280-335 aa of NM_001040142 Sequence: MQWPPDNSSFEINITSFFNNSLDGNGTTFNRTVSIFNWDEYIEDKSHFYFLEGQNDA Predict reactive species\nFull Name: sodium channel, voltage-gated, type II, alpha subunit\nCalculated Molecular Weight: 228 kDa\nObserved Molecular Weight: ~250 kDa\nGenBank Accession Number: NM_001040142\nGene Symbol: SCN2A\nGene ID (NCBI): 6326\nRRID: AB_3085969\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q99250\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869761261737,"sku":"27551-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27551-1-ap","provider":"Iright","version":"1.0","type":"link"}