{"product_id":"proteintech-27552-1-ap","title":"Proteintech, 27552-1-AP, Galectin-4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Galectin-4 (27552-1-AP) by Proteintech is a Polyclonal antibody targeting Galectin-4 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n27552-1-AP targets Galectin-4 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat colon tissue, mouse small intestine tissue,  mouse colon tissue\nPositive IHC detected in: human colon cancer tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HT-29 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:50-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGalectins are a family of animal lectins defined by shared characteristic amino-acid sequences and affinity for β-galactose-containing oligosac-charides (PMID: 8063692). Galectin-4 contains two arbohydrate recognition domains (CRDs) and is expressed in the epithelium of oral mucosa, esophagus, and intestinal and colonic mucosa (PMID: 15546874; 15115909). Aberrant expression of galectin-4 has been reported in several cancers.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26130 Product name: Recombinant human LGALS4,GAL4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 70-240 aa of BC034750 Sequence: GWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFIGGQPLRPQGPPMMPPYPGPGHCHQQLNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSSGDIALHINPR Predict reactive species\nFull Name: lectin, galactoside-binding, soluble, 4\nCalculated Molecular Weight: 323 aa, 36 kDa\nObserved Molecular Weight: 34-36 kDa\nGenBank Accession Number: BC034750\nGene Symbol: Galectin-4\nGene ID (NCBI): 3960\nRRID: AB_2880903\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P56470\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869543387305,"sku":"27552-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27552-1-ap","provider":"Iright","version":"1.0","type":"link"}