{"product_id":"proteintech-27563-1-ap","title":"Proteintech, 27563-1-AP, CD64 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD64 (27563-1-AP) by Proteintech is a Polyclonal antibody targeting CD64 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n27563-1-AP targets CD64 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: THP-1 cells, U-937 cells,  HL-60 cells\nPositive IF\/ICC detected in: THP-1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFcγ receptor comprise a multigene family of integral membrane glycoproteins that exhibit complex activation or inhibitory effects on cell functions after aggregation by complexed immunoglobulin G (IgG) (PMID: 17005690 ). CD64, also known as FcγRIA, is a high affinity receptor for the Fc region of IgG. It is expressed by monocytes\/macrophages, activated neutrophils, dendritic cells, and early myeloid cells (PMID: 23293080; 19642859; 7680917). CD64 functions in both innate and adaptive immune responses. The calculated molecular weight of CD64 is 43 kDa, while the glycosylated CD64 has a higher apparent molecular weight.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26727 Product name: Recombinant human FCGR1A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 311-374 aa of BC032634 Sequence: VTIRKELKRKKKWDLEISLDSGHEKKVISSLQEDRHLEEELKCQEQKEEQLQEGVHRKEPQGAT Predict reactive species\nFull Name: Fc fragment of IgG, high affinity Ia, receptor (CD64)\nCalculated Molecular Weight: 374 aa, 43 kDa\nObserved Molecular Weight: 65-70 kDa, 43-45 kDa\nGenBank Accession Number: BC032634\nGene Symbol: FCGR1A\nGene ID (NCBI): 2209\nENSEMBL Gene ID: ENSG00000150337\nRRID: AB_2880909\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P12314\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869653389481,"sku":"27563-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27563-1-ap","provider":"Iright","version":"1.0","type":"link"}