{"product_id":"proteintech-27571-1-ap","title":"Proteintech, 27571-1-AP, GLUT5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GLUT5 (27571-1-AP) by Proteintech is a Polyclonal antibody targeting GLUT5 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n27571-1-AP targets GLUT5 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Caco-2 cells, A549 cells,  mouse kidney tissue,  rat testis tissue\nPositive IHC detected in: human breast cancer tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGLUT5, also known as SLC2A5, is a fructose transporter expressed on the apical border of enterocytes in the small intestine. GLUT5 allows for fructose to be transported from the intestinal lumen into the enterocyte by facilitated diffusion due to fructose's high concentration in the intestinal lumen (PMID: 12750891). GLUT5 is also expressed in skeletal muscle, testis, kidney, fat tissue (adipocytes), and brain (PMID: 9781312, 18398011).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25682 Product name: Recombinant human SLC2A5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 357-399 aa of BC001820 Sequence: CVLTAALALQDTVSWMPYISIVCVISYVIGHALGPSPIPALLI Predict reactive species\nFull Name: solute carrier family 2 (facilitated glucose\/fructose transporter), member 5\nCalculated Molecular Weight: 55 kDa\nObserved Molecular Weight: 48-70 kDa\nGenBank Accession Number: BC001820\nGene Symbol: GLUT5\nGene ID (NCBI): 6518\nRRID: AB_2880913\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P22732\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868933869737,"sku":"27571-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27571-1-ap","provider":"Iright","version":"1.0","type":"link"}