{"product_id":"proteintech-27573-1-ap","title":"Proteintech, 27573-1-AP, MAP7D3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MAP7D3 (27573-1-AP) by Proteintech is a Polyclonal antibody targeting MAP7D3 in WB, ELISA applications with reactivity to human samples\n27573-1-AP targets MAP7D3 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, Calu-1 cells,  HeLa cells,  MDA-MB-468 cells,  SH-SY5Y cells,  SK-N-SH cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMAP7D3, also known as MDP3, features two coiled-coil regions near its N terminus, followed by a linker region, a MAP7-like domain, and a C-terminal domain. MAP7D3 is a microtubule-binding protein that regulates microtubule assembly and stability. MAP7D3 expression is cell cycle dependent, with lower expression in the G2 phase compared to its expression in the other phases of the cell cycle(PMID: 22142902).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26082 Product name: Recombinant human MAP7D3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 301-400 aa of NM_001173516 Sequence: ASVDAPPQVNVEVFCNTSMEASPKAGVGMAPEVSTDSFPVVSVDVSPVVSTYDSEMSMDASPELSIEALPKVDLETVPKVSIVASPEASLEAPPEVSLEA Predict reactive species\nFull Name: MAP7 domain containing 3\nCalculated Molecular Weight: 98 kDa\nObserved Molecular Weight: 125-130 kDa\nGenBank Accession Number: NM_001173516\nGene Symbol: MAP7D3\nGene ID (NCBI): 79649\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8IWC1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887713079465,"sku":"27573-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27573-1-ap","provider":"Iright","version":"1.0","type":"link"}