{"product_id":"proteintech-27585-1-ap","title":"Proteintech, 27585-1-AP, TMEM119 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TMEM119 (27585-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM119 in IHC, IF-P, FC (Intra), ELISA applications with reactivity to human, mouse samples\n27585-1-AP targets TMEM119 in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue, mouse liver tissue\nPositive FC (Intra) detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTMEM119 immunohistochemistry might provide a useful tool for investigating the biology and pathology of human microglia(PMID: 26250788). Microglia can be detected clearly using Catalog#27585-1-AP.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26269 Product name: Recombinant human TMEM119 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 119-218 aa of NM_181724 Sequence: MRQKQKASAYYPSSFPKKKYVDQSDRAGGPRAFSEVPDRAPDSRPEEALDSSRQLQADILAATQNLKSPTRAALGGGDGARMVEGRGAEEEEKGSQEGDQE Predict reactive species\nFull Name: transmembrane protein 119\nCalculated Molecular Weight: 29 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: NM_181724\nGene Symbol: TMEM119\nGene ID (NCBI): 338773\nRRID: AB_2880915\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q4V9L6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868872626345,"sku":"27585-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27585-1-ap","provider":"Iright","version":"1.0","type":"link"}