{"product_id":"proteintech-27591-1-ap","title":"Proteintech, 27591-1-AP, SLC24A3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC24A3 (27591-1-AP) by Proteintech is a Polyclonal antibody targeting SLC24A3 in WB, ELISA applications with reactivity to human, mouse, rat samples\n27591-1-AP targets SLC24A3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, mouse heart tissue,  rat brain tissue,  rat heart tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC24A3, also known as NCKX3 (Na⁺\/K⁺\/Ca²⁺ exchanger 3), is a member of the solute carrier family 24 (SLC24), which comprises five K⁺-dependent Na⁺\/Ca²⁺ exchangers (NCKX1-5). These transporters are critical for maintaining intracellular calcium homeostasis by coupling the extrusion of one Ca²⁺ ion and one K⁺ ion to the influx of four Na⁺ ions. SLC24A3 plays a key role in calcium signaling and homeostasis, influencing processes such as neurotransmission, smooth muscle contraction, and female reproductive physiology. Relatively high levels of SLC24A3 expression can be observed in heart tissue, consistent with the expression patterns reported in the literature. The observed molecular weight of SLC24A3 is 50-60 kDa, which is consistent with the literature description. (PMID: 21573014, PMID: 28588505)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26297 Product name: Recombinant human SLC24A3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 361-450 aa of NM_020689 Sequence: MSRAYTNGESEVAIKIPIKHTVENGTGPSSAPDRGVNGTRRDDVVAEAGNETENENEDNENDEEEEEDEDDDEGPYTPFDTPSGKLETVKW Predict reactive species\nFull Name: solute carrier family 24 (sodium\/potassium\/calcium exchanger), member 3\nCalculated Molecular Weight: 72 kDa\nObserved Molecular Weight: 50-60 kDa\nGenBank Accession Number: NM_020689\nGene Symbol: SLC24A3\nGene ID (NCBI): 57419\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9HC58\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887804534953,"sku":"27591-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27591-1-ap","provider":"Iright","version":"1.0","type":"link"}