{"product_id":"proteintech-27592-1-ap","title":"Proteintech, 27592-1-AP, RACK1; GNB2L1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RACK1; GNB2L1 (27592-1-AP) by Proteintech is a Polyclonal antibody targeting RACK1; GNB2L1 in WB, IHC, ELISA applications with reactivity to Human, mouse, rat samples\n27592-1-AP targets RACK1; GNB2L1 in WB, IHC, IF, IP, CoIP, RIP, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue, L02 cells,  HepG2 cells,  rat liver tissue\nPositive IHC detected in: human liver cancer tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMembers of the protein kinase C (PKC) family play a key regulatory role in a variety of cellular functions, including cell growth and differentiation, gene expression, hormone secretion and membrane function. RACK1 (receptor for activated protein kinase C 1), encoded by GNB2L1 gene, is a 317 amino acid guanine nucleotide-binding protein subunit beta-2-like 1 protein which is involved in the recruitment, assembly and\/or regulation of a variety of signaling molecules, it contains 7 WD-repeats and is implicated in various protein interaction activities. RACK1 is a component of the 40S ribosomal subunit involved in translational repression. Recent finding suggests that RACK1 may be a new promising diagnosis biomarker and therapeutic target for non-small-cell lung cancer (NSCLC).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nCited Reactivity: human, mouse, pig, monkey\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26708 Product name: Recombinant human RACK1; GNB2L1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 131-317 aa of BC019093 Sequence: LWNTLGVCKYTVQDESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGKIIVDELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQVTIGTR Predict reactive species\nFull Name: guanine nucleotide binding protein (G protein), beta polypeptide 2-like 1\nCalculated Molecular Weight: 36 kDa\nObserved Molecular Weight: 31 kDa\nGenBank Accession Number: BC019093\nGene Symbol: RACK1\nGene ID (NCBI): 10399\nRRID: AB_2880917\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P63244\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868877181097,"sku":"27592-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27592-1-ap","provider":"Iright","version":"1.0","type":"link"}