{"product_id":"proteintech-27600-1-ap","title":"Proteintech, 27600-1-AP, CIDEB Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CIDEB (27600-1-AP) by Proteintech is a Polyclonal antibody targeting CIDEB in WB, IHC, ELISA applications with reactivity to Human, mouse samples\n27600-1-AP targets CIDEB in WB, IHC, ELISA applications and shows reactivity with Human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, L02 cells\nPositive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCell death‐inducing DFFA‐like effector B (CIDEB), an ER and lipid droplet (LD)‐associated protein primarily expressed in the liver, participated in lipid metabolism by regulating lipid droplet fusion and VLDL lipidation. Although CIDEA is expressed at high levels in brown adipose tissue (BAT) and CIDEC is highly enriched in white adipose tissue (WAT) and BAT, CIDEB is more abundant in liver, kidney, small intestine, and colon. CIDEB is localized to endoplasmic reticulum and lipid droplets. (PMID: 30858281, PMID: 24831470, PMID: 19187774)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27003 Product name: Recombinant human CIDEB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 39-179 aa of BC035970 Sequence: RVCDHKRTIRKGLTAATRQELLAKALETLLLNGVLTLVLEEDGTAVDSEDFFQLLEDDTCLMVLQSGQSWSPTRSGVLSYGLGRERPKHSKDIARFTFDVYKQNPRDLFGSLNVKATFYGLYSMSCDFQGLGPKKVLRELL Predict reactive species\nFull Name: cell death-inducing DFFA-like effector b\nCalculated Molecular Weight: 219 aa, 28 kDa\nObserved Molecular Weight: 28 kDa\nGenBank Accession Number: BC035970\nGene Symbol: CIDEB\nGene ID (NCBI): 27141\nRRID: AB_2880922\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UHD4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868995440809,"sku":"27600-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27600-1-ap","provider":"Iright","version":"1.0","type":"link"}