{"product_id":"proteintech-27606-1-ap","title":"Proteintech, 27606-1-AP, RanBP2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RanBP2 (27606-1-AP) by Proteintech is a Polyclonal antibody targeting RanBP2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n27606-1-AP targets RanBP2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  Ramos cells,  Y79 cells\nPositive IHC detected in: rat liver tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRanBP2 (Ran-binding protein 2) is also named as p270 and NUP358, and belongs to the RanBP2 E3 ligase family. RanBP2 is E3 SUMO-protein ligase which facilitates SUMO1 and SUMO2 conjugation by UBE2I (PMID:11792325, PMID:22194619). RanBP2 involved in transport factor (Ran-GTP, karyopherin)-mediated protein import via the F-G repeat-containing domain which acts as a docking site for substrates (PMID:7775481). It is component of the nuclear export pathway (PMID:10078529). RanBP2 recruits BICD2 to the nuclear envelope and cytoplasmic stacks of nuclear pore complex known as annulate lamellae during G2 phase of cell cycle (PMID:20386726).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26370 Product name: Recombinant human RANBP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2801-2900 aa of NM_006267 Sequence: MKSISSPSVSSETMDKPVDLSTRKEIDTDSTSQGESKIVSFGFGSSTGLSFADLASSNSGDFAFGSKDKNFQWANTGAAVFGTQSVGTQSAGKVGEDEDGS Predict reactive species\nFull Name: RAN binding protein 2\nCalculated Molecular Weight: 358 kDa\nObserved Molecular Weight: 358 kDa\nGenBank Accession Number: NM_006267\nGene Symbol: RANBP2\nGene ID (NCBI): 5903\nRRID: AB_2880923\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P49792\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869492990121,"sku":"27606-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27606-1-ap","provider":"Iright","version":"1.0","type":"link"}