{"product_id":"proteintech-27615-1-ap","title":"Proteintech, 27615-1-AP, E2F3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe E2F3 (27615-1-AP) by Proteintech is a Polyclonal antibody targeting E2F3 in WB, ELISA applications with reactivity to human samples\n27615-1-AP targets E2F3 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SGC-7901 cells, SKOV-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nE2F transcription factors regulate gene expression in concert with the retinoblastoma tumor suppressor family. These transcriptional complexes are master regulators of cell cycle progression, control the expression of genes involved in DNA repair, G2\/M checkpoint and differentiation [PMID:22580460]. E2f3 is a transcription activator that binds DNA cooperatively with DP proteins through the E2 recognition site, 5'-TTTC[CG]CGC-3' found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication. The DRTF1\/E2F complex functions in the control of cell-cycle progression from G1 to S phase. E2F3 binds specifically to RB1 in a cell-cycle dependent manner [PMID:22960857].\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26367 Product name: Recombinant human E2F3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 54-155 aa of NM_001243076 Sequence: MPGAYIQILTTNTSTTSCSSSLQSGAVAAGPLLPSAPGAEQTAGSLLYTTPHGPSSRAGLLQQPPALGRGGSGGGGGPPAKRRLELGESGHQYLSDGLKTPKG Predict reactive species\nFull Name: E2F transcription factor 3\nCalculated Molecular Weight: 49 kDa\nObserved Molecular Weight: 60-65 kDa\nGenBank Accession Number: NM_001243076\nGene Symbol: E2F3\nGene ID (NCBI): 1871\nRRID: AB_2880926\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O00716\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868901658793,"sku":"27615-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27615-1-ap","provider":"Iright","version":"1.0","type":"link"}