{"product_id":"proteintech-27622-1-ap","title":"Proteintech, 27622-1-AP, HOXA5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HOXA5 (27622-1-AP) by Proteintech is a Polyclonal antibody targeting HOXA5 in WB, IF\/ICC, IP, ELISA applications with reactivity to human samples\n27622-1-AP targets HOXA5 in WB, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HEK-293 cells\nPositive IP detected in: HEK-293 cells\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHOXA5 (Homeobox A5) is a member of the homeobox gene family, which plays a crucial role in embryonic development, cell differentiation, and tissue patterning (PMID: 31159758). These genes encode transcription factors containing a conserved homeodomain that binds DNA to regulate the expression of target genes involved in morphogenesis and organogenesis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26362 Product name: Recombinant human HOXA5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 64-163 aa of BC013682 Sequence: FGSGERARSYAASASAAPAEPRYSQPATSTHSPQPDPLPCSAVAPSPGSDSHHGGKNSLSNSSGASADAGSTHISSREGVGTASGAEEDAPASSEQASAQ Predict reactive species\nFull Name: homeobox A5\nCalculated Molecular Weight: 270 aa, 29 kDa\nObserved Molecular Weight: 38-42 kDa\nGenBank Accession Number: BC013682\nGene Symbol: HOXA5\nGene ID (NCBI): 3202\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P20719\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887670055081,"sku":"27622-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27622-1-ap","provider":"Iright","version":"1.0","type":"link"}