{"product_id":"proteintech-27635-1-ap","title":"Proteintech, 27635-1-AP, BACH2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BACH2 (27635-1-AP) by Proteintech is a Polyclonal antibody targeting BACH2 in WB, ELISA applications with reactivity to Human samples\n27635-1-AP targets BACH2 in WB, IHC, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Daudi cells, Ramos cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBACH2, also named as Transcription regulator protein BACH2, is a 841 amino acid protein, which is widely expressed within the B-lymphoid lineage, except in plasma cells. BACH2 contains an N-terminal BTB domain involved in its transcriptional function, but instead of having zinc fingers at the C-terminus, it binds to DNA through a basic leucine zipper motif. BACH2 binds DNA consensus sequences, termed MARE motifs, by forming a heterodimer with small leucine zipper MAF proteins such as MAFK, MAFG, and MAFF. The calculated molecular weight of BACH2 is 92 kDa, but the post-modifiction of BACH2 is about 120-130 kDa. (PMID: 24277074 )\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26526 Product name: Recombinant human BACH2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 136-235 aa of NM_001170794 Sequence: MSEDGLFVCRKDAACQRPHEDCENSAGEEEDEEEETMDSETAKMACPRDQMLPEPISFEAAAIPVAEKEEALLPEPDVPTDTKESSEKDALTQYPRYKKYQ Predict reactive species\nFull Name: BTB and CNC homology 1, basic leucine zipper transcription factor 2\nCalculated Molecular Weight: 93 kDa\nObserved Molecular Weight: 120-130 kDa\nGenBank Accession Number: NM_001170794\nGene Symbol: BACH2\nGene ID (NCBI): 60468\nRRID: AB_2880934\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BYV9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869446164649,"sku":"27635-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27635-1-ap","provider":"Iright","version":"1.0","type":"link"}