{"product_id":"proteintech-27655-1-ap","title":"Proteintech, 27655-1-AP, ZFX Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZFX (27655-1-AP) by Proteintech is a Polyclonal antibody targeting ZFX in WB, ELISA applications with reactivity to Human, rat samples\n27655-1-AP targets ZFX in WB, ELISA applications and shows reactivity with Human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HL-60 cells, HeLa cells,  K-562 cells,  PC-12 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZFX (Zinc finger protein, X-linked), a key factor that controls the self-renewal of ESCs, belongs to the ZFY family whose members (ZFX, ZFY, ZFA) have similar molecular structures. Mammalian ZFX contains an acidic transcriptional activation domain, a nuclear localization signal (NLS) sequence, and a DNA binding domain consisting of 13 C2H2 zinc fingers.  Knocking out ZFX has been shown to impair the self-renewal capacity of mouse ESC and tissue-specific adult stem cell such as hematopoietic stem cells (HSCs) without affecting\ntheir differentiation, and ZFX overexpression has been shown to promote ESC self-renewal by impeding differentiation. It's reported that t the 130 kDa band was N-glycosylated, and such a posttranslational modification (PTM) may control the nuclear import of ZFX, 91 kDa may be  the non-N-glycosylated subtype which was lowly expressed. (PMID: 23322077, PMID:24228108)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26576 Product name: Recombinant human ZFX protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 711-805 aa of NM_001178084 Sequence: MSVHTKDLPFRCKRCRKGFRQQSELKKHMKTHSGRKVYQCEYCEYSTTDASGFKRHVISIHTKDYPHRCEYCKKGFRRPSEKNQHIMRHHKEVGLP Predict reactive species\nFull Name: zinc finger protein, X-linked\nCalculated Molecular Weight: 91 kDa\nObserved Molecular Weight: ~130 kDa\nGenBank Accession Number: NM_001178084\nGene Symbol: ZFX\nGene ID (NCBI): 7543\nRRID: AB_3085980\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P17010\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869795078313,"sku":"27655-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27655-1-ap","provider":"Iright","version":"1.0","type":"link"}