{"product_id":"proteintech-27667-1-ap","title":"Proteintech, 27667-1-AP, RSL1D1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RSL1D1 (27667-1-AP) by Proteintech is a Polyclonal antibody targeting RSL1D1 in WB, IHC, ELISA applications with reactivity to Human, mouse samples\n27667-1-AP targets RSL1D1 in WB, IHC, ELISA applications and shows reactivity with Human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: U-251 cells, HCT 116 cells,  HEK-293 cells,  SW480 cells,  K-562 cells,  HepG2 cells,  PC-3 cells\nPositive IHC detected in: mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRL1D1, Ribosomal L1 domain-containing protein 1, also named CSIG, a member of the universal ribosomal protein uL1 family. RL1D1 regulates cellular senescence through inhibition of PTEN translation. It acts as a pro-apoptotic regulator in response to DNA damage (PMID: 18678645, PMID: 22419112). RSL1D1 promoted the progression of colorectal cancer through RAN-mediated autophagy suppression. RSL1D1 can be detected 70 kDa (PMID:35013134).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24923 Product name: Recombinant human RSL1D1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 269-490 aa of BC112228 Sequence: SNWDEATKRSLLNKKKKEARRKRRERNFEKQKERKKKRQQARKTASVLSKDDVAPESGDTTVKKPESKKEQTPEHGKKKRGRGKAQVKATNESEDEIPQLVPIGKKTPANEKVEIQKHATGKKSPAKSPNPSTPRGKKRKALPASETPKAAESETPGKSPEKKPKIKEEAVKEKSPSLGKKDARQTPKKPEAKFFTTPSKSVRKASHTPKKWPKKPKVPQST Predict reactive species\nFull Name: ribosomal L1 domain containing 1\nCalculated Molecular Weight: 490 aa, 55 kDa\nObserved Molecular Weight: 55-70 kDa\nGenBank Accession Number: BC112228\nGene Symbol: RSL1D1\nGene ID (NCBI): 26156\nRRID: AB_3085982\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O76021\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869759426729,"sku":"27667-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27667-1-ap","provider":"Iright","version":"1.0","type":"link"}